Sideroflexin 4 antibody (C-Term)

Catalog No. ABIN635574

Product Details anti-Sideroflexin 4 Antibody

Target: Sideroflexin 4 (SFXN4)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sideroflexin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Sideroflexin 4 antibody was raised against the C terminal of SFXN4

Purification: Affinity purified

Immunogen: Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Sideroflexin 4 Blocking Peptide, catalog no. 33R-8343, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sideroflexin 4

Target: Sideroflexin 4 (SFXN4)

Alternative Name: Sideroflexin 4 (SFXN4 Products)

Synonyms: im:7151335 antibody, si:ch211-117n7.3 antibody, zgc:153199 antibody, BCRM1 antibody, sideroflexin 4 antibody, Sfxn4 antibody, SFXN4 antibody, sfxn4 antibody

Background: SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis