TMPRSS5 antibody

Catalog No. ABIN635571

Product Details anti-TMPRSS5 Antibody

Target: TMPRSS5 (Transmembrane Protease, serine 5 (TMPRSS5))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMPRSS5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TMPRSS5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN

Application Details

Application Notes: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMPRSS5 Blocking Peptide, catalog no. 33R-8944, is also available for use as a blocking control in assays to test for specificity of this TMPRSS5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMPRSS5

Target: TMPRSS5 (Transmembrane Protease, serine 5 (TMPRSS5))

Alternative Name: TMPRSS5 (TMPRSS5 Products)

Synonyms: TMPRSS5 antibody, SPINESIN antibody, Amp antibody, spinesin antibody, transmembrane protease, serine 5 antibody, transmembrane protease, serine 5 (spinesin) antibody, TMPRSS5 antibody, Tmprss5 antibody

Background: TMPRSS5 belongs to the serine protease family. Serine proteases are known to be involved in many physiological and pathological processes. TMPRSS5 may play a role in hearing.

Molecular Weight: 22 kDa (MW of target protein)