POMT2 antibody (Middle Region)
-
- Target See all POMT2 Antibodies
- POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POMT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- POMT2 antibody was raised against the middle region of POMT2
- Purification
- Affinity purified
- Immunogen
- POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS
- Top Product
- Discover our top product POMT2 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POMT2 Blocking Peptide, catalog no. 33R-1266, is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))
- Alternative Name
- POMT2 (POMT2 Products)
- Synonyms
- CG12311 antibody, DPOMT2 antibody, DmPOMT2 antibody, Dmel\\CG12311 antibody, EG:34F3.7 antibody, POMT2 antibody, Pomt2 antibody, dPOMT2 antibody, im:7153045 antibody, zPOMT2 antibody, zgc:158749 antibody, LGMD2N antibody, MDDGA2 antibody, MDDGB2 antibody, MDDGC2 antibody, A830009D15Rik antibody, AW046274 antibody, twisted antibody, protein O-mannosyltransferase 2 antibody, protein-O-mannosyltransferase 2 antibody, tw antibody, POMT2 antibody, pomt2 antibody, Pomt2 antibody
- Background
- POMT2 is an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S. cerevisiae.
- Molecular Weight
- 38 kDa (MW of target protein)
-