PCDH15 antibody (N-Term)
-
- Target See all PCDH15 Antibodies
- PCDH15 (Protocadherin-15 (PCDH15))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCDH15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCDH15 antibody was raised against the N terminal of PCDH15
- Purification
- Affinity purified
- Immunogen
- PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP
- Top Product
- Discover our top product PCDH15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCDH15 Blocking Peptide, catalog no. 33R-3853, is also available for use as a blocking control in assays to test for specificity of this PCDH15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDH15 (Protocadherin-15 (PCDH15))
- Alternative Name
- PCDH15 (PCDH15 Products)
- Background
- PCDH15 is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. PCDH15 consists of a signal peptide, 11 extracellular calcium-binding domains, a transmembrane domain and a unique cytoplasmic domain. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene have been associated with hearing loss, which is consistent with its location at the Usher syndrome type 1F (USH1F) critical region on chromosome 10.
- Molecular Weight
- 80 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-