SUN2 antibody

Catalog No. ABIN635564

Product Details anti-SUN2 Antibody

Target: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUN2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UNC84 B antibody was raised using a synthetic peptide corresponding to a region with amino acids CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNC84B Blocking Peptide, catalog no. 33R-1831, is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUN2

Target: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Alternative Name: UNC84B (SUN2 Products)

Synonyms: UNC84B antibody, B230369L08Rik antibody, C030011B15 antibody, Unc84b antibody, RGD1563141 antibody, Sad1 and UNC84 domain containing 2 antibody, SUN2 antibody, Sun2 antibody

Background: UNC84B plays a role in mitotic spindle organization and biogenesis.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection