TMEM209 antibody (N-Term)

Catalog No. ABIN635561

Product Details anti-TMEM209 Antibody

Target: TMEM209 (Transmembrane Protein 209 (TMEM209))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM209 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FLJ14803 antibody was raised against the N terminal Of Flj14803

Purification: Affinity purified

Immunogen: FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ14803 Blocking Peptide, catalog no. 33R-6235, is also available for use as a blocking control in assays to test for specificity of this FLJ14803 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ14803 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM209

Target: TMEM209 (Transmembrane Protein 209 (TMEM209))

Alternative Name: FLJ14803 (TMEM209 Products)

Synonyms: flj14803 antibody, fc20f10 antibody, wu:fc20f10 antibody, NET31 antibody, 2700094F01Rik antibody, AI428435 antibody, RGD1309682 antibody, transmembrane protein 209 antibody, transmembrane protein 209 S homeolog antibody, tmem209 antibody, TMEM209 antibody, Tmem209 antibody, tmem209.S antibody

Background: The specific function of FLJ14803 is not yet known.

Molecular Weight: 62 kDa (MW of target protein)