TMEM209 antibody (N-Term)
-
- Target See all TMEM209 products
- TMEM209 (Transmembrane Protein 209 (TMEM209))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM209 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FLJ14803 antibody was raised against the N terminal Of Flj14803
- Purification
- Affinity purified
- Immunogen
- FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FLJ14803 Blocking Peptide, catalog no. 33R-6235, is also available for use as a blocking control in assays to test for specificity of this FLJ14803 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ14803 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM209 (Transmembrane Protein 209 (TMEM209))
- Alternative Name
- FLJ14803 (TMEM209 Products)
- Synonyms
- flj14803 antibody, fc20f10 antibody, wu:fc20f10 antibody, NET31 antibody, 2700094F01Rik antibody, AI428435 antibody, RGD1309682 antibody, transmembrane protein 209 antibody, transmembrane protein 209 S homeolog antibody, tmem209 antibody, TMEM209 antibody, Tmem209 antibody, tmem209.S antibody
- Background
- The specific function of FLJ14803 is not yet known.
- Molecular Weight
- 62 kDa (MW of target protein)
-