FIBCD1 antibody (C-Term)

Catalog No. ABIN635560

Product Details anti-FIBCD1 Antibody

Target: FIBCD1 (Fibrinogen C Domain Containing 1 (FIBCD1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FIBCD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FIBCD1 antibody was raised against the C terminal of FIBCD1

Purification: Affinity purified

Immunogen: FIBCD1 antibody was raised using the C terminal of FIBCD1 corresponding to a region with amino acids DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FIBCD1 Blocking Peptide, catalog no. 33R-1972, is also available for use as a blocking control in assays to test for specificity of this FIBCD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FIBCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FIBCD1

Target: FIBCD1 (Fibrinogen C Domain Containing 1 (FIBCD1))

Alternative Name: FIBCD1 (FIBCD1 Products)

Synonyms: fibcd1 antibody, AI448887 antibody, RGD1309097 antibody, fibrinogen C domain containing 1 antibody, fibrinogen C domain containing 1 L homeolog antibody, FIBCD1 antibody, fibcd1.L antibody, Fibcd1 antibody

Background: FIBCD1 is a single-pass membrane protein. It contains 1 fibrinogen C-terminal domain. The exact function of FIBCD1 remains unknown.

Molecular Weight: 51 kDa (MW of target protein)