ABCC1 antibody

Catalog No. ABIN635554

Product Details anti-ABCC1 Antibody

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCC1 Blocking Peptide, catalog no. 33R-4941, is also available for use as a blocking control in assays to test for specificity of this ABCC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCC1

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Alternative Name: ABCC1 (ABCC1 Products)

Synonyms: ABC29 antibody, ABCC antibody, GS-X antibody, MRP antibody, MRP1 antibody, Abcc1a antibody, Abcc1b antibody, Mdrap antibody, Mrp1 antibody, Avcc1a antibody, Mrp antibody, ABCC13 antibody, ATP binding cassette subfamily C member 1 antibody, ATP-binding cassette, sub-family C (CFTR/MRP), member 1 antibody, multidrug resistance-associated protein 1 antibody, ABCC1 antibody, Abcc1 antibody, LOC100152428 antibody, LOC100346553 antibody

Background: ABCC1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates.

Molecular Weight: 171 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome