SC5DL antibody

Catalog No. ABIN635551

Product Details anti-SC5DL Antibody

Target: SC5DL (Sterol-C5-Desaturase (SC5DL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SC5DL antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SC5 DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SC5DL Blocking Peptide, catalog no. 33R-6850, is also available for use as a blocking control in assays to test for specificity of this SC5DL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 L antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SC5DL

Target: SC5DL (Sterol-C5-Desaturase (SC5DL))

Alternative Name: SC5DL (SC5DL Products)

Synonyms: A830037K02 antibody, A830073K23Rik antibody, Sc5dl antibody, ERG3 antibody, S5DES antibody, SC5DL antibody, sc5d antibody, sc5dl antibody, sterol-C5-desaturase antibody, sterol-C5-desaturase L homeolog antibody, Sc5d antibody, SC5D antibody, sc5d.L antibody

Background: This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.

Molecular Weight: 35 kDa (MW of target protein)