OCA2 antibody (Middle Region)

Catalog No. ABIN635550

Product Details anti-OCA2 Antibody

Target: OCA2 (P Protein (OCA2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OCA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OCA2 antibody was raised against the middle region of OCA2

Purification: Affinity purified

Immunogen: OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OCA2 Blocking Peptide, catalog no. 33R-5036, is also available for use as a blocking control in assays to test for specificity of this OCA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-OCA2 antibody (ABIN635550)

Jeffery: "Distal Regeneration Involves the Age Dependent Activity of Branchial Sac Stem Cells in the Ascidian Ciona intestinalis." in: Regeneration (Oxford, England), Vol. 2, Issue 1, pp. 1-18, (2015) (PubMed).

Target Details for OCA2

Target: OCA2 (P Protein (OCA2))

Alternative Name: OCA2 (OCA2 Products)

Synonyms: D7H15S12 antibody, D7Icr28RN antibody, D7Nic1 antibody, p antibody, BEY antibody, BEY1 antibody, BEY2 antibody, BOCA antibody, D15S12 antibody, EYCL antibody, EYCL2 antibody, EYCL3 antibody, HCL3 antibody, P antibody, PED antibody, SHEP1 antibody, OCA2 antibody, P protein antibody, oculocutaneous albinism II antibody, OCA2 melanosomal transmembrane protein antibody, P antibody, p antibody, Oca2 antibody, OCA2 antibody, oca2 antibody

Target Type: Viral Protein

Background: This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism.

Molecular Weight: 93 kDa (MW of target protein)