AWAT2 antibody (C-Term)
-
- Target See all AWAT2 products
- AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AWAT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DGAT2 L4 antibody was raised against the C terminal of DGAT2 4
- Purification
- Affinity purified
- Immunogen
- DGAT2 L4 antibody was raised using the C terminal of DGAT2 4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DGAT2L4 Blocking Peptide, catalog no. 33R-3242, is also available for use as a blocking control in assays to test for specificity of this DGAT2L4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGAT0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))
- Alternative Name
- DGAT2L4 (AWAT2 Products)
- Synonyms
- DGAT2L4 antibody, ARAT antibody, DC4 antibody, MFAT antibody, WS antibody, 9430062J17Rik antibody, Dgat2l4 antibody, RGD1565111 antibody, acyl-CoA wax alcohol acyltransferase 2 antibody, AWAT2 antibody, Awat2 antibody
- Background
- DGAT2L4 is acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. It has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols.
- Molecular Weight
- 38 kDa (MW of target protein)
-