GOLGA5 antibody (N-Term)

Catalog No. ABIN635542

Product Details anti-GOLGA5 Antibody

Target: GOLGA5 (Golgin A5 (GOLGA5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GOLGA5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GOLGA5 antibody was raised against the N terminal of GOLGA5

Purification: Affinity purified

Immunogen: GOLGA5 antibody was raised using the N terminal of GOLGA5 corresponding to a region with amino acids FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOLGA5 Blocking Peptide, catalog no. 33R-3120, is also available for use as a blocking control in assays to test for specificity of this GOLGA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GOLGA5

Target: GOLGA5 (Golgin A5 (GOLGA5))

Alternative Name: GOLGA5 (GOLGA5 Products)

Synonyms: GOLIM5 antibody, RFG5 antibody, ret-II antibody, golim5 antibody, ret-ii antibody, rfg5 antibody, Ret-II antibody, im:7153094 antibody, sb:cb898 antibody, wu:fd50h11 antibody, zgc:66400 antibody, golgin A5 antibody, golgin A5 L homeolog antibody, golgi autoantigen, golgin subfamily a, 5 antibody, GOLGA5 antibody, golga5.L antibody, golga5 antibody, Golga5 antibody

Background: GOLGA5 is a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues.

Molecular Weight: 83 kDa (MW of target protein)