SAYSD1 antibody (C-Term)

Catalog No. ABIN635537

Product Details anti-SAYSD1 Antibody

Target: SAYSD1 (SAYSVFN Motif Domain Containing 1 (SAYSD1))

Binding Specificity: C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAYSD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C6 ORF64 antibody was raised against the C terminal Of C6 rf64

Purification: Affinity purified

Immunogen: C6 ORF64 antibody was raised using the C terminal Of C6 rf64 corresponding to a region with amino acids MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF64 Blocking Peptide, catalog no. 33R-6632, is also available for use as a blocking control in assays to test for specificity of this C6ORF64 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAYSD1

Target: SAYSD1 (SAYSVFN Motif Domain Containing 1 (SAYSD1))

Alternative Name: C6ORF64 (SAYSD1 Products)

Synonyms: C6orf64 antibody, SAYSD1 antibody, C23H6orf64 antibody, 1810063B07Rik antibody, 4930488P03Rik antibody, SAYSVFN motif domain containing 1 antibody, SAYSD1 antibody, Saysd1 antibody

Background: The function of C6orf64 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 20 kDa (MW of target protein)