Seladin 1 antibody (Middle Region)
-
- Target See all Seladin 1 (DHCR24) Antibodies
- Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Seladin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DHCR24 antibody was raised against the middle region of DHCR24
- Purification
- Affinity purified
- Immunogen
- DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
- Top Product
- Discover our top product DHCR24 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHCR24 Blocking Peptide, catalog no. 33R-1138, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))
- Alternative Name
- DHCR24 (DHCR24 Products)
- Synonyms
- MGC82737 antibody, zgc:101638 antibody, DCE antibody, Nbla03646 antibody, SELADIN1 antibody, seladin-1 antibody, 2310076D10Rik antibody, 5830417J06Rik antibody, mKIAA0018 antibody, 24-dehydrocholesterol reductase antibody, 24-dehydrocholesterol reductase S homeolog antibody, delta(24)-sterol reductase antibody, DHCR24 antibody, dhcr24.S antibody, dhcr24 antibody, LOC5575872 antibody, CpipJ_CPIJ000670 antibody, Dhcr24 antibody
- Background
- DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis.
- Molecular Weight
- 58 kDa (MW of target protein)
-