WDR33 antibody (N-Term)
-
- Target See all WDR33 Antibodies
- WDR33 (WD Repeat Domain 33 (WDR33))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WDR33 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WDR33 antibody was raised against the N terminal of WDR33
- Purification
- Affinity purified
- Immunogen
- WDR33 antibody was raised using the N terminal of WDR33 corresponding to a region with amino acids IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC
- Top Product
- Discover our top product WDR33 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WDR33 Blocking Peptide, catalog no. 33R-4214, is also available for use as a blocking control in assays to test for specificity of this WDR33 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR33 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDR33 (WD Repeat Domain 33 (WDR33))
- Alternative Name
- WDR33 (WDR33 Products)
- Background
- WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
- Molecular Weight
- 38 kDa (MW of target protein)
-