ABHD13 antibody (N-Term)

Catalog No. ABIN635522

Product Details anti-ABHD13 Antibody

Target: ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABHD13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ABHD13 antibody was raised against the N terminal of ABHD13

Purification: Affinity purified

Immunogen: ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABHD13 Blocking Peptide, catalog no. 33R-8762, is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABHD13

Target: ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))

Alternative Name: ABHD13 (ABHD13 Products)

Synonyms: BEM46L1 antibody, C13orf6 antibody, RP11-153I24.2 antibody, bA153I24.2 antibody, 1110065L07Rik antibody, AI463703 antibody, AI788994 antibody, RGD1308317 antibody, zgc:123286 antibody, abhydrolase domain containing 13 antibody, abhydrolase domain containing 13 S homeolog antibody, ABHD13 antibody, abhd13 antibody, abhd13.S antibody, Abhd13 antibody

Background: ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.

Molecular Weight: 38 kDa (MW of target protein)