ERVW-1 antibody (N-Term)
-
- Target See all ERVW-1 Antibodies
- ERVW-1 (Endogenous Retrovirus Group W, Member 1 (ERVW-1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERVW-1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ERVWE1 antibody was raised against the N terminal of ERVWE1
- Purification
- Affinity purified
- Immunogen
- ERVWE1 antibody was raised using the N terminal of ERVWE1 corresponding to a region with amino acids TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR
- Top Product
- Discover our top product ERVW-1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ERVWE1 Blocking Peptide, catalog no. 33R-9252, is also available for use as a blocking control in assays to test for specificity of this ERVWE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERVWE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERVW-1 (Endogenous Retrovirus Group W, Member 1 (ERVW-1))
- Alternative Name
- ERVWE1 (ERVW-1 Products)
- Background
- ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
- Molecular Weight
- 24 kDa (MW of target protein)
-