ERVW-1 antibody (N-Term)

Catalog No. ABIN635520

Product Details anti-ERVW-1 Antibody

Target: ERVW-1 (Endogenous Retrovirus Group W, Member 1 (ERVW-1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERVW-1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ERVWE1 antibody was raised against the N terminal of ERVWE1

Purification: Affinity purified

Immunogen: ERVWE1 antibody was raised using the N terminal of ERVWE1 corresponding to a region with amino acids TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERVWE1 Blocking Peptide, catalog no. 33R-9252, is also available for use as a blocking control in assays to test for specificity of this ERVWE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERVWE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERVW-1

Target: ERVW-1 (Endogenous Retrovirus Group W, Member 1 (ERVW-1))

Alternative Name: ERVWE1 (ERVW-1 Products)

Synonyms: ENV antibody, ENVW antibody, ERVWE1 antibody, HERV-7q antibody, HERV-W-ENV antibody, HERV7Q antibody, HERVW antibody, HERVWENV antibody, endogenous retrovirus group W member 1, envelope antibody, ERVW-1 antibody

Background: ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Molecular Weight: 24 kDa (MW of target protein)