ODF4 antibody (N-Term)
-
- Target See all ODF4 Antibodies
- ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ODF4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ODF4 antibody was raised against the N terminal of ODF4
- Purification
- Affinity purified
- Immunogen
- ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL
- Top Product
- Discover our top product ODF4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ODF4 Blocking Peptide, catalog no. 33R-5818, is also available for use as a blocking control in assays to test for specificity of this ODF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))
- Alternative Name
- ODF4 (ODF4 Products)
- Synonyms
- CT134 antibody, CT136 antibody, OPPO1 antibody, Oppo1 antibody, outer dense fiber of sperm tails 4 antibody, ODF4 antibody, Odf4 antibody
- Background
- ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.
- Molecular Weight
- 29 kDa (MW of target protein)
-