Claudin 18 antibody (C-Term)
-
- Target See all Claudin 18 (CLDN18) Antibodies
- Claudin 18 (CLDN18)
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Claudin 18 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Claudin 18 antibody was raised against the C terminal of CLDN18
- Purification
- Affinity purified
- Immunogen
- Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE
- Top Product
- Discover our top product CLDN18 Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Claudin 18 Blocking Peptide, catalog no. 33R-7040, is also available for use as a blocking control in assays to test for specificity of this Claudin 18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 18 (CLDN18)
- Alternative Name
- Claudin 18 (CLDN18 Products)
- Background
- CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-