Claudin 18 antibody (C-Term)

Catalog No. ABIN635505

Product Details anti-Claudin 18 Antibody

Target: Claudin 18 (CLDN18)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin 18 antibody was raised against the C terminal of CLDN18

Purification: Affinity purified

Immunogen: Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 18 Blocking Peptide, catalog no. 33R-7040, is also available for use as a blocking control in assays to test for specificity of this Claudin 18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 18

Target: Claudin 18 (CLDN18)

Alternative Name: Claudin 18 (CLDN18 Products)

Synonyms: claudin-18 antibody, CLDN18 antibody, SFTA5 antibody, SFTPJ antibody, claudin 18 L homeolog antibody, claudin 18 antibody, cldn18.L antibody, CLDN18 antibody, Cldn18 antibody

Background: CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C