INSIG2 antibody (N-Term)
-
- Target See all INSIG2 Antibodies
- INSIG2 (Insulin Induced Gene 2 (INSIG2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This INSIG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- INSIG2 antibody was raised against the N terminal of INSIG2
- Purification
- Affinity purified
- Immunogen
- INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ
- Top Product
- Discover our top product INSIG2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
INSIG2 Blocking Peptide, catalog no. 33R-5639, is also available for use as a blocking control in assays to test for specificity of this INSIG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- INSIG2 (Insulin Induced Gene 2 (INSIG2))
- Alternative Name
- INSIG2 (INSIG2 Products)
- Background
- INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-