Sphingomyelin Synthase 2 antibody (N-Term)

Catalog No. ABIN635498

Product Details anti-Sphingomyelin Synthase 2 Antibody

Target: Sphingomyelin Synthase 2 (SGMS2)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sphingomyelin Synthase 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SGMS2 antibody was raised against the N terminal of SGMS2

Purification: Affinity purified

Immunogen: SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SGMS2 Blocking Peptide, catalog no. 33R-4377, is also available for use as a blocking control in assays to test for specificity of this SGMS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sphingomyelin Synthase 2

Target: Sphingomyelin Synthase 2 (SGMS2)

Alternative Name: SGMS2 (SGMS2 Products)

Synonyms: SMS2 antibody, 4933405A16Rik antibody, 5133401H06Rik antibody, AI854299 antibody, RGD1305778 antibody, spermatin antibody, sphingomyelin synthase 2 antibody, sgms2 antibody, SGMS2 antibody, Sgms2 antibody

Background: SGMS2 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. SGMS2 directly and specifically recognises the choline head group on the substrate. SGMS2 also requires two fatty chains on the choline-P donor molecule in order to be recognised efficiently as a substrate. SGMS2 does not function strictly as a SM synthase.

Molecular Weight: 42 kDa (MW of target protein)