LRRC37B antibody (N-Term)

Catalog No. ABIN635493

Product Details anti-LRRC37B Antibody

Target: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC37B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC37 B antibody was raised against the N terminal of LRRC37

Purification: Affinity purified

Immunogen: LRRC37 B antibody was raised using the N terminal of LRRC37 corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC37B Blocking Peptide, catalog no. 33R-9822, is also available for use as a blocking control in assays to test for specificity of this LRRC37B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC37B

Target: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Alternative Name: LRRC37B (LRRC37B Products)

Synonyms: DKFZp459F1551 antibody, leucine rich repeat containing 37B antibody, leucine-rich repeat-containing protein 37B antibody, LRRC37B antibody, LOC749894 antibody

Background: The function of LRRC37B protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 105 kDa (MW of target protein)