SPNS1/Spinster 1 antibody

Catalog No. ABIN635490

Product Details anti-SPNS1/Spinster 1 Antibody

Target: SPNS1/Spinster 1 (SPNS1) (Spinster Homolog 1 (SPNS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPNS1/Spinster 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SPNS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPNS1 Blocking Peptide, catalog no. 33R-1219, is also available for use as a blocking control in assays to test for specificity of this SPNS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPNS1/Spinster 1

Target: SPNS1/Spinster 1 (SPNS1) (Spinster Homolog 1 (SPNS1))

Alternative Name: SPNS1 (SPNS1 Products)

Synonyms: etID64740.3 antibody, nrs antibody, spinl antibody, wu:fb95b12 antibody, wu:fi37e11 antibody, 2210013K02Rik antibody, Spin1 antibody, Spinl antibody, HSpin1 antibody, LAT antibody, PP2030 antibody, SPIN1 antibody, SPINL antibody, spinster antibody, RGD1305613 antibody, sphingolipid transporter 1 (putative) antibody, spinster homolog 1 (Drosophila) antibody, spinster homolog 1 antibody, spinster homolog 1 L homeolog antibody, sphingolipid transporter 1 antibody, SPNS1 antibody, spns1 antibody, Spns1 antibody, spns1.L antibody

Background: SPNS1 is the Sphingolipid transporter. It may be involved in necrotic or autophagic cell death. It belongs to the major facilitator superfamily, spinster family.

Molecular Weight: 56 kDa (MW of target protein)