TSPAN10 antibody (N-Term)

Catalog No. ABIN635489

Product Details anti-TSPAN10 Antibody

Target: TSPAN10 (Tetraspanin 10 (TSPAN10))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPAN10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 10 antibody was raised against the N terminal of TSPAN10

Purification: Affinity purified

Immunogen: Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 10 Blocking Peptide, catalog no. 33R-8345, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPAN10

Target: TSPAN10 (Tetraspanin 10 (TSPAN10))

Alternative Name: Tetraspanin 10 (TSPAN10 Products)

Synonyms: GB13074 antibody, OCSP antibody, Ocsp antibody, tetraspanin 10 antibody, tetraspanin-10 antibody, Tspan10 antibody, TSPAN10 antibody, LOC483364 antibody

Background: TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.

Molecular Weight: 37 kDa (MW of target protein)