ESYT3 antibody

Catalog No. ABIN635487

Product Details anti-ESYT3 Antibody

Target: ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ESYT3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM62C Blocking Peptide, catalog no. 33R-8085, is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ESYT3

Target: ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))

Alternative Name: FAM62C (ESYT3 Products)

Synonyms: Fam62c antibody, RGD1561304 antibody, fam62a antibody, fam62c antibody, FAM62A antibody, im:7153182 antibody, si:ch211-219a4.7 antibody, FAM62C antibody, DKFZp459I013 antibody, CHR3SYT antibody, E-Syt3 antibody, D930024E11 antibody, D9Ertd280e antibody, mKIAA4186 antibody, extended synaptotagmin 3 antibody, extended synaptotagmin protein 3 antibody, extended synaptotagmin-like protein 3 antibody, extended synaptotagmin-3 antibody, Esyt3 antibody, ESYT3 antibody, esyt3 antibody, LOC100468549 antibody, LOC100594943 antibody

Background: FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.

Molecular Weight: 100 kDa (MW of target protein)