FTHL17 antibody (N-Term)

Catalog No. ABIN635486

Product Details anti-FTHL17 Antibody

Target: FTHL17 (Ferritin, Heavy Polypeptide-Like 17 (FTHL17))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FTHL17 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FTHL17 antibody was raised against the N terminal of FTHL17

Purification: Affinity purified

Immunogen: FTHL17 antibody was raised using the N terminal of FTHL17 corresponding to a region with amino acids MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FTHL17 Blocking Peptide, catalog no. 33R-5656, is also available for use as a blocking control in assays to test for specificity of this FTHL17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTHL17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FTHL17

Target: FTHL17 (Ferritin, Heavy Polypeptide-Like 17 (FTHL17))

Alternative Name: FTHL17 (FTHL17 Products)

Synonyms: CT38 antibody, ferritin heavy chain like 17 antibody, ferritin, heavy polypeptide-like 17, member E antibody, FTHL17 antibody, Fthl17e antibody

Background: This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis