STEAP4 antibody (C-Term)

Catalog No. ABIN635483

Product Details anti-STEAP4 Antibody

Target: STEAP4 (STEAP Family Member 4 (STEAP4))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STEAP4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STEAP4 antibody was raised against the C terminal of STEAP4

Purification: Affinity purified

Immunogen: STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STEAP4 Blocking Peptide, catalog no. 33R-1165, is also available for use as a blocking control in assays to test for specificity of this STEAP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STEAP4

Target: STEAP4 (STEAP Family Member 4 (STEAP4))

Alternative Name: STEAP4 (STEAP4 Products)

Synonyms: STAMP2 antibody, TIARP antibody, TNFAIP9 antibody, MGC68826 antibody, STEAP4 antibody, MGC108044 antibody, steap4 antibody, 1110021O17Rik antibody, AI481214 antibody, Tiarp antibody, Tnfaip9 antibody, si:dkey-53p21.1 antibody, zgc:112143 antibody, STEAP4 metalloreductase antibody, STEAP4 metalloreductase L homeolog antibody, metalloreductase STEAP4 antibody, STEAP family member 4 antibody, STEAP4 antibody, steap4.L antibody, Steap4 antibody, steap4 antibody, LOC100136336 antibody, LOC100353852 antibody

Background: Metalloreductase has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It uses NAD(+) as acceptor.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis