MGC4172 (Middle Region) antibody
-
- Target
- MGC4172
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MGC4172 antibody was raised against the middle region of MGC4172
- Purification
- Affinity purified
- Immunogen
- MGC4172 antibody was raised using the middle region of MGC4172 corresponding to a region with amino acids DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MGC4172 Blocking Peptide, catalog no. 33R-1951, is also available for use as a blocking control in assays to test for specificity of this MGC4172 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC4172 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MGC4172
- Background
- The function of MGC4172 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 28 kDa (MW of target protein)
-