FAM134A antibody (N-Term)
-
- Target See all FAM134A products
- FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM134A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM134 A antibody was raised against the N terminal of FAM134
- Purification
- Affinity purified
- Immunogen
- FAM134 A antibody was raised using the N terminal of FAM134 corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM134A Blocking Peptide, catalog no. 33R-1221, is also available for use as a blocking control in assays to test for specificity of this FAM134A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))
- Alternative Name
- FAM134A (FAM134A Products)
- Synonyms
- C2orf17 antibody, RGD1306844 antibody, reticulophagy regulator family member 2 antibody, RETREG2 antibody, Retreg2 antibody
- Background
- The function of FAM134 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 58 kDa (MW of target protein)
-