FAM134A antibody (N-Term)

Catalog No. ABIN635481

Product Details anti-FAM134A Antibody

Target: FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM134A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM134 A antibody was raised against the N terminal of FAM134

Purification: Affinity purified

Immunogen: FAM134 A antibody was raised using the N terminal of FAM134 corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM134A Blocking Peptide, catalog no. 33R-1221, is also available for use as a blocking control in assays to test for specificity of this FAM134A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM134A

Target: FAM134A (Family with Sequence Similarity 134, Member A (FAM134A))

Alternative Name: FAM134A (FAM134A Products)

Synonyms: C2orf17 antibody, RGD1306844 antibody, reticulophagy regulator family member 2 antibody, RETREG2 antibody, Retreg2 antibody

Background: The function of FAM134 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 58 kDa (MW of target protein)