TMEM38A antibody (N-Term)

Catalog No. ABIN635479

Product Details anti-TMEM38A Antibody

Target: TMEM38A (Transmembrane Protein 38A (TMEM38A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM38A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM38 A antibody was raised against the N terminal of TMEM38

Purification: Affinity purified

Immunogen: TMEM38 A antibody was raised using the N terminal of TMEM38 corresponding to a region with amino acids GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM38A Blocking Peptide, catalog no. 33R-3241, is also available for use as a blocking control in assays to test for specificity of this TMEM38A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM38A

Target: TMEM38A (Transmembrane Protein 38A (TMEM38A))

Alternative Name: TMEM38A (TMEM38A Products)

Synonyms: zgc:77831 antibody, MGC75707 antibody, TMEM38A antibody, TRIC-A antibody, TRICA antibody, 1110001E17Rik antibody, AI413399 antibody, mg33a antibody, RGD1307901 antibody, Srp-27 antibody, transmembrane protein 38A antibody, transmembrane protein 38a antibody, transmembrane protein 38A L homeolog antibody, tmem38a antibody, CpipJ_CPIJ011791 antibody, CpipJ_CPIJ013655 antibody, TMEM38A antibody, Tmem38a antibody, tmem38a.L antibody

Background: TMEM38A is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

Molecular Weight: 33 kDa (MW of target protein)