CATSPERG antibody (C-Term)

Catalog No. ABIN635477

Product Details anti-CATSPERG Antibody

Target: CATSPERG (Cation Channel, Sperm-Associated, gamma (CATSPERG))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CATSPERG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C19 ORF15 antibody was raised against the C terminal Of C19 rf15

Purification: Affinity purified

Immunogen: C19 ORF15 antibody was raised using the C terminal Of C19 rf15 corresponding to a region with amino acids FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF15 Blocking Peptide, catalog no. 33R-2894, is also available for use as a blocking control in assays to test for specificity of this C19ORF15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CATSPERG

Target: CATSPERG (Cation Channel, Sperm-Associated, gamma (CATSPERG))

Alternative Name: C19ORF15 (CATSPERG Products)

Synonyms: C19orf15 antibody, cation channel sperm associated auxiliary subunit gamma antibody, CATSPERG antibody

Background: C19orf15 is a single-pass type I membrane protein. The exact function of C19orf15 remains unknown.

Molecular Weight: 92 kDa (MW of target protein)