CATSPERG antibody (C-Term)
-
- Target See all CATSPERG Antibodies
- CATSPERG (Cation Channel, Sperm-Associated, gamma (CATSPERG))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CATSPERG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C19 ORF15 antibody was raised against the C terminal Of C19 rf15
- Purification
- Affinity purified
- Immunogen
- C19 ORF15 antibody was raised using the C terminal Of C19 rf15 corresponding to a region with amino acids FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK
- Top Product
- Discover our top product CATSPERG Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C19ORF15 Blocking Peptide, catalog no. 33R-2894, is also available for use as a blocking control in assays to test for specificity of this C19ORF15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CATSPERG (Cation Channel, Sperm-Associated, gamma (CATSPERG))
- Alternative Name
- C19ORF15 (CATSPERG Products)
- Synonyms
- C19orf15 antibody, cation channel sperm associated auxiliary subunit gamma antibody, CATSPERG antibody
- Background
- C19orf15 is a single-pass type I membrane protein. The exact function of C19orf15 remains unknown.
- Molecular Weight
- 92 kDa (MW of target protein)
-