TMCO1 antibody (C-Term)

Catalog No. ABIN635466

Product Details anti-TMCO1 Antibody

Target: TMCO1 (Transmembrane and Coiled-Coil Domains 1 (TMCO1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMCO1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMCO1 antibody was raised against the C terminal of TMCO1

Purification: Affinity purified

Immunogen: TMCO1 antibody was raised using the C terminal of TMCO1 corresponding to a region with amino acids CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMCO1 Blocking Peptide, catalog no. 33R-1807, is also available for use as a blocking control in assays to test for specificity of this TMCO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMCO1

Target: TMCO1 (Transmembrane and Coiled-Coil Domains 1 (TMCO1))

Alternative Name: TMCO1 (TMCO1 Products)

Synonyms: DKFZp459A2226 antibody, sb:cb729 antibody, zgc:110322 antibody, zgc:92740 antibody, HP10122 antibody, PCIA3 antibody, PNAS-136 antibody, RP11-466F5.7 antibody, TMCC4 antibody, 1190006A08Rik antibody, 4930403O06Rik antibody, AA109065 antibody, AU022572 antibody, ESTM39 antibody, transmembrane and coiled-coil domains 1 antibody, transmembrane and coiled-coil domains 1 S homeolog antibody, TMCO1 antibody, tmco1 antibody, tmco1.S antibody, Tmco1 antibody

Background: TMCO1 belongs to the TMCO1 family. The exact function of TMCO1 remains unknown.

Molecular Weight: 21 kDa (MW of target protein)