LRRC59 antibody (C-Term)
-
- Target See all LRRC59 Antibodies
- LRRC59 (Leucine Rich Repeat Containing 59 (LRRC59))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRC59 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC59 antibody was raised against the C terminal of LRRC59
- Purification
- Affinity purified
- Immunogen
- LRRC59 antibody was raised using the C terminal of LRRC59 corresponding to a region with amino acids KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL
- Top Product
- Discover our top product LRRC59 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC59 Blocking Peptide, catalog no. 33R-4365, is also available for use as a blocking control in assays to test for specificity of this LRRC59 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC59 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC59 (Leucine Rich Repeat Containing 59 (LRRC59))
- Alternative Name
- LRRC59 (LRRC59 Products)
- Synonyms
- p34 antibody, PRO1855 antibody, AA959742 antibody, C78668 antibody, leucine rich repeat containing 59 antibody, leucine rich repeat containing 59 S homeolog antibody, LRRC59 antibody, Lrrc59 antibody, lrrc59.S antibody
- Background
- The function of LRRC59 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 35 kDa (MW of target protein)
-