TEX2 antibody (N-Term)

Catalog No. ABIN635462

Product Details anti-TEX2 Antibody

Target: TEX2 (Testis Expressed 2 (TEX2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TEX2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TEX2 antibody was raised against the N terminal of TEX2

Purification: Affinity purified

Immunogen: TEX2 antibody was raised using the N terminal of TEX2 corresponding to a region with amino acids KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TEX2 Blocking Peptide, catalog no. 33R-4657, is also available for use as a blocking control in assays to test for specificity of this TEX2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TEX2

Target: TEX2 (Testis Expressed 2 (TEX2))

Alternative Name: TEX2 (TEX2 Products)

Synonyms: HT008 antibody, TMEM96 antibody, 4930568E07Rik antibody, AI553404 antibody, Def-5 antibody, Taz4 antibody, testis expressed 2 antibody, testis expressed gene 2 antibody, TEX2 antibody, Tex2 antibody

Background: TEX2 is a multi-pass membrane protein. The exact function of TEX2 remains unknown.

Molecular Weight: 126 kDa (MW of target protein)