C7orf42 antibody (N-Term)

Catalog No. ABIN635459

Product Details anti-C7orf42 Antibody

Target: C7orf42 (Chromosome 7 Open Reading Frame 42 (C7orf42))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C7orf42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C7 ORF42 antibody was raised against the N terminal Of C7 rf42

Purification: Affinity purified

Immunogen: C7 ORF42 antibody was raised using the N terminal Of C7 rf42 corresponding to a region with amino acids FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C7ORF42 Blocking Peptide, catalog no. 33R-3065, is also available for use as a blocking control in assays to test for specificity of this C7ORF42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C7orf42

Target: C7orf42 (Chromosome 7 Open Reading Frame 42 (C7orf42))

Alternative Name: C7ORF42 (C7orf42 Products)

Synonyms: C7orf42 antibody, c7orf42 antibody, TMEM248 antibody, MGC79534 antibody, C25H7orf42 antibody, 0610007L01Rik antibody, A930023A16Rik antibody, AW557951 antibody, G430067H08Rik antibody, zgc:103561 antibody, transmembrane protein 248 antibody, transmembrane protein 248 L homeolog antibody, TMEM248 antibody, tmem248.L antibody, tmem248 antibody, Tmem248 antibody

Background: The function of C7orf42 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 35 kDa (MW of target protein)