SUSD4 antibody (N-Term)

Catalog No. ABIN635457

Product Details anti-SUSD4 Antibody

Target: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUSD4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SUSD4 antibody was raised against the N terminal of SUSD4

Purification: Affinity purified

Immunogen: SUSD4 antibody was raised using the N terminal of SUSD4 corresponding to a region with amino acids MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SUSD4 Blocking Peptide, catalog no. 33R-6626, is also available for use as a blocking control in assays to test for specificity of this SUSD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUSD4

Target: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Alternative Name: SUSD4 (SUSD4 Products)

Synonyms: susd4 antibody, MGC146481 antibody, DKFZp469E106 antibody, PRO222 antibody, AI848994 antibody, E430021N18Rik antibody, N28096 antibody, RGD1564043 antibody, sushi domain containing 4 antibody, toll-like receptor 5 antibody, SUSD4 antibody, tlr5 antibody, Susd4 antibody

Background: SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.

Molecular Weight: 32 kDa (MW of target protein)