HLC8 antibody (N-Term)

Catalog No. ABIN635456

Product Details anti-HLC8 Antibody

Target: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HLC8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C17 ORF80 antibody was raised against the N terminal Of C17 rf80

Purification: Affinity purified

Immunogen: C17 ORF80 antibody was raised using the N terminal Of C17 rf80 corresponding to a region with amino acids MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C17ORF80 Blocking Peptide, catalog no. 33R-6409, is also available for use as a blocking control in assays to test for specificity of this C17ORF80 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HLC8

Target: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Alternative Name: C17ORF80 (C17orf80 Products)

Synonyms: HLC-8 antibody, MIG3 antibody, SPEP1 antibody, mig3 antibody, hlc-8 antibody, chromosome 17 open reading frame 80 antibody, chromosome 18 open reading frame, human C17orf80 antibody, chromosome 17 open reading frame, human C17orf80 antibody, DNA segment, Chr 11, Wayne State University 47, expressed antibody, C17orf80 antibody, C17ORF80 antibody, C17H17orf80 antibody, c17orf80 antibody, D11Wsu47e antibody

Background: The function of C17orf80 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 67 kDa (MW of target protein)