FAM70A antibody (N-Term)

Catalog No. ABIN635455

Product Details anti-FAM70A Antibody

Target: FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM70A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM70 A antibody was raised against the N terminal of FAM70

Purification: Affinity purified

Immunogen: FAM70 A antibody was raised using the N terminal of FAM70 corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM70A Blocking Peptide, catalog no. 33R-4195, is also available for use as a blocking control in assays to test for specificity of this FAM70A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM70A

Target: FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))

Alternative Name: FAM70A (FAM70A Products)

Synonyms: FAM70A antibody, 4933417N17 antibody, 6430550H21Rik antibody, Fam70a antibody, RGD727788 antibody, fam70a antibody, transmembrane protein 255A antibody, transmembrane protein 255A L homeolog antibody, TMEM255A antibody, Tmem255a antibody, tmem255a.L antibody, tmem255a antibody

Background: The function of FAM70A protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 38 kDa (MW of target protein)