FAM70A antibody (N-Term)
-
- Target See all FAM70A products
- FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM70A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM70 A antibody was raised against the N terminal of FAM70
- Purification
- Affinity purified
- Immunogen
- FAM70 A antibody was raised using the N terminal of FAM70 corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM70A Blocking Peptide, catalog no. 33R-4195, is also available for use as a blocking control in assays to test for specificity of this FAM70A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))
- Alternative Name
- FAM70A (FAM70A Products)
- Synonyms
- FAM70A antibody, 4933417N17 antibody, 6430550H21Rik antibody, Fam70a antibody, RGD727788 antibody, fam70a antibody, transmembrane protein 255A antibody, transmembrane protein 255A L homeolog antibody, TMEM255A antibody, Tmem255a antibody, tmem255a.L antibody, tmem255a antibody
- Background
- The function of FAM70A protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 38 kDa (MW of target protein)
-