TMEM127 antibody (Middle Region)

Catalog No. ABIN635454

Product Details anti-TMEM127 Antibody

Target: TMEM127 (Transmembrane Protein 127 (TMEM127))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM127 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM127 antibody was raised against the middle region of TMEM127

Purification: Affinity purified

Immunogen: TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM127 Blocking Peptide, catalog no. 33R-1166, is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM127 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM127

Target: TMEM127 (Transmembrane Protein 127 (TMEM127))

Alternative Name: TMEM127 (TMEM127 Products)

Synonyms: zgc:109899 antibody, 2310003P10Rik antibody, AI314202 antibody, AI317350 antibody, RGD1309744 antibody, transmembrane protein 127 antibody, transmembrane protein 127 S homeolog antibody, tmem127 antibody, TMEM127 antibody, tmem127.S antibody, Tmem127 antibody

Background: TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.

Molecular Weight: 26 kDa (MW of target protein)