TMEM161A antibody (Middle Region)
-
- Target See all TMEM161A products
- TMEM161A (Transmembrane Protein 161A (TMEM161A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM161A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM161 A antibody was raised against the middle region of TMEM161
- Purification
- Affinity purified
- Immunogen
- TMEM161 A antibody was raised using the middle region of TMEM161 corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM161A Blocking Peptide, catalog no. 33R-5117, is also available for use as a blocking control in assays to test for specificity of this TMEM161A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM161A (Transmembrane Protein 161A (TMEM161A))
- Alternative Name
- TMEM161A (TMEM161A Products)
- Background
- TMEM161A may be involved in the development of dendritic cells.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- Positive Regulation of Response to DNA Damage Stimulus
-