C19orf56 antibody (N-Term)
-
- Target See all C19orf56 products
- C19orf56 (Chromosome 19 Open Reading Frame 56 (C19orf56))
- Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C19orf56 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- C19 ORF56 antibody was raised against the N terminal Of C19 rf56
- Purification
- Affinity purified
- Immunogen
- C19 ORF56 antibody was raised using the N terminal Of C19 rf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C19ORF56 Blocking Peptide, catalog no. 33R-8878, is also available for use as a blocking control in assays to test for specificity of this C19ORF56 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C19orf56 (Chromosome 19 Open Reading Frame 56 (C19orf56))
- Alternative Name
- C19ORF56 (C19orf56 Products)
- Synonyms
- MGC81480 antibody, C19orf56 antibody, PTD008 antibody, C7H19orf56 antibody, WD repeat domain 83 opposite strand L homeolog antibody, WD repeat domain 83 opposite strand antibody, wdr83os.L antibody, WDR83OS antibody, wdr83os antibody
- Background
- The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 12 kDa (MW of target protein)
-