PTDSS1 antibody (N-Term)

Catalog No. ABIN635446

Product Details anti-PTDSS1 Antibody

Target: PTDSS1 (phosphatidylserine Synthase 1 (PTDSS1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTDSS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTDSS1 antibody was raised against the N terminal of PTDSS1

Purification: Affinity purified

Immunogen: PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTDSS1 Blocking Peptide, catalog no. 33R-5738, is also available for use as a blocking control in assays to test for specificity of this PTDSS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTDSS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTDSS1

Target: PTDSS1 (phosphatidylserine Synthase 1 (PTDSS1))

Alternative Name: PTDSS1 (PTDSS1 Products)

Synonyms: PSS-1 antibody, zgc:55906 antibody, PSS1 antibody, PSSA antibody, AU044268 antibody, AW539008 antibody, mKIAA0024 antibody, phosphatidylserine synthase 1a antibody, phosphatidylserine synthase 1 antibody, ptdss1a antibody, PTDSS1 antibody, Ptdss1 antibody

Background: PTDSS1 is a multi-pass membrane protein. It belongs to the phosphatidyl serine synthase family. PTDSS1 catalyzes a base-exchange reaction in which the polar head group of phosphatidylcholine is replaced by L-serine.

Molecular Weight: 55 kDa (MW of target protein)