TM9SF4 antibody (N-Term)

Catalog No. ABIN635445

Product Details anti-TM9SF4 Antibody

Target: TM9SF4 (Transmembrane 9 Superfamily Protein Member 4 (TM9SF4))

Binding Specificity: N-Term

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TM9SF4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TM9 SF4 antibody was raised against the N terminal of TM9 F4

Purification: Affinity purified

Immunogen: TM9 SF4 antibody was raised using the N terminal of TM9 F4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TM9SF4 Blocking Peptide, catalog no. 33R-3826, is also available for use as a blocking control in assays to test for specificity of this TM9SF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TM9SF4

Target: TM9SF4 (Transmembrane 9 Superfamily Protein Member 4 (TM9SF4))

Alternative Name: TM9SF4 (TM9SF4 Products)

Synonyms: dJ836N17.2 antibody, AA986553 antibody, AU045326 antibody, B930079E06 antibody, mKIAA0255 antibody, transmembrane 9 superfamily member 4 antibody, transmembrane 9 superfamily protein member 4 antibody, TM9SF4 antibody, Tm9sf4 antibody

Background: TM9SF4 is required for phagocytosis in S2 cells.

Molecular Weight: 72 kDa (MW of target protein)