EDEM1 antibody (N-Term)
-
- Target See all EDEM1 Antibodies
- EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EDEM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EDEM1 antibody was raised against the N terminal of EDEM1
- Purification
- Affinity purified
- Immunogen
- EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI
- Top Product
- Discover our top product EDEM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EDEM1 Blocking Peptide, catalog no. 33R-5674, is also available for use as a blocking control in assays to test for specificity of this EDEM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDEM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))
- Alternative Name
- EDEM1 (EDEM1 Products)
- Background
- EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.
- Molecular Weight
- 74 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-