Ferric-Chelate Reductase 1 Like (FRRS1L) (Middle Region) antibody
-
- Target See all Ferric-Chelate Reductase 1 Like (FRRS1L) Antibodies
- Ferric-Chelate Reductase 1 Like (FRRS1L)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C9 ORF4 antibody was raised against the middle region of C9 rf4
- Purification
- Affinity purified
- Immunogen
- C9 ORF4 antibody was raised using the middle region of C9 rf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP
- Top Product
- Discover our top product FRRS1L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C9ORF4 Blocking Peptide, catalog no. 33R-3707, is also available for use as a blocking control in assays to test for specificity of this C9ORF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ferric-Chelate Reductase 1 Like (FRRS1L)
- Alternative Name
- C9ORF4 (FRRS1L Products)
- Synonyms
- C9orf4 antibody, CG-6 antibody, CG6 antibody, 6430704M03Rik antibody, ferric chelate reductase 1 like antibody, ferric-chelate reductase 1 like antibody, FRRS1L antibody, Frrs1l antibody
- Background
- The function of C9orf4 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 37 kDa (MW of target protein)
-