ST6GALNAC6 antibody (C-Term)

Catalog No. ABIN635440

Product Details anti-ST6GALNAC6 Antibody

Target: ST6GALNAC6 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6 (ST6GALNAC6))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST6GALNAC6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ST6 GALNAC6 antibody was raised against the C terminal of ST6 ALNAC6

Purification: Affinity purified

Immunogen: ST6 GALNAC6 antibody was raised using the C terminal of ST6 ALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST6GALNAC6 Blocking Peptide, catalog no. 33R-10129, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST6GALNAC6

Target: ST6GALNAC6 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6 (ST6GALNAC6))

Alternative Name: ST6GALNAC6 (ST6GALNAC6 Products)

Synonyms: RP11-203J24.3 antibody, SIAT7F antibody, ST6GALNACVI antibody, siat7f antibody, st6GalNAc-VI antibody, Siat7f antibody, MGC109387 antibody, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 antibody, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 antibody, ST6GALNAC6 antibody, St6galnac6 antibody

Background: ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

Molecular Weight: 38 kDa (MW of target protein)