CHIC2 antibody (N-Term)

Catalog No. ABIN635436

Product Details anti-CHIC2 Antibody

Target: CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHIC2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CHIC2 antibody was raised against the N terminal of CHIC2

Purification: Affinity purified

Immunogen: CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHIC2 Blocking Peptide, catalog no. 33R-2382, is also available for use as a blocking control in assays to test for specificity of this CHIC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHIC2

Target: CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))

Alternative Name: CHIC2 (CHIC2 Products)

Synonyms: zgc:55670 antibody, BTL antibody, 1700081B18Rik antibody, 4930502K01Rik antibody, cysteine rich hydrophobic domain 2 antibody, cysteine-rich hydrophobic domain 2 antibody, cysteine rich hydrophobic domain 2 S homeolog antibody, CHIC2 antibody, CpipJ_CPIJ013126 antibody, chic2 antibody, chic2.S antibody, Chic2 antibody

Background: CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. CHIC2 gene is associated with some cases of acute myeloid leukemia.

Molecular Weight: 19 kDa (MW of target protein)