RER1 antibody

Catalog No. ABIN635434

Product Details anti-RER1 Antibody

Target: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RER1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RER1 Blocking Peptide, catalog no. 33R-3349, is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RER1

Target: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Alternative Name: RER1 (RER1 Products)

Synonyms: RER1 antibody, DKFZp459K116 antibody, rer1 antibody, zgc:65968 antibody, 1110060F11Rik antibody, 5830454N22Rik antibody, AU043380 antibody, RGD1306324 antibody, retention in endoplasmic reticulum sorting receptor 1 antibody, RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) antibody, retention in endoplasmic reticulum sorting receptor 1 L homeolog antibody, RER1 antibody, rer1 antibody, rer1.L antibody, Rer1 antibody

Background: RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

Molecular Weight: 23 kDa (MW of target protein)