LARGE antibody (Middle Region)
-
- Target See all LARGE Antibodies
- LARGE (Like-Glycosyltransferase (LARGE))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LARGE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LARGE antibody was raised against the middle region of LARGE
- Purification
- Affinity purified
- Immunogen
- LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE
- Top Product
- Discover our top product LARGE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LARGE Blocking Peptide, catalog no. 33R-1247, is also available for use as a blocking control in assays to test for specificity of this LARGE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARGE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LARGE (Like-Glycosyltransferase (LARGE))
- Alternative Name
- LARGE (LARGE Products)
- Synonyms
- gyltl1b antibody, gyltl1b-b antibody, mdc1d antibody, MDC1D antibody, MDDGA6 antibody, MDDGB6 antibody, BPFD36 antibody, Gyltl1a antibody, Mbp-1 antibody, Mbp1 antibody, enr antibody, fg antibody, froggy antibody, mKIAA0609 antibody, myd antibody, NV15834 antibody, DKFZp459G0120 antibody, LARGE xylosyl- and glucuronyltransferase 1 L homeolog antibody, LARGE xylosyl- and glucuronyltransferase 1 antibody, glycosyltransferase-like protein LARGE1 antibody, like-glycosyltransferase antibody, large1.L antibody, LARGE1 antibody, Large1 antibody, large1 antibody, LOC100118066 antibody, LARGE antibody, Large antibody
- Background
- This gene, which is one of the largest in the human genome, encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan.
- Molecular Weight
- 88 kDa (MW of target protein)
-