LARGE antibody (Middle Region)

Catalog No. ABIN635429

Product Details anti-LARGE Antibody

Target: LARGE (Like-Glycosyltransferase (LARGE))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LARGE antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LARGE antibody was raised against the middle region of LARGE

Purification: Affinity purified

Immunogen: LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LARGE Blocking Peptide, catalog no. 33R-1247, is also available for use as a blocking control in assays to test for specificity of this LARGE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARGE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LARGE

Target: LARGE (Like-Glycosyltransferase (LARGE))

Alternative Name: LARGE (LARGE Products)

Synonyms: gyltl1b antibody, gyltl1b-b antibody, mdc1d antibody, MDC1D antibody, MDDGA6 antibody, MDDGB6 antibody, BPFD36 antibody, Gyltl1a antibody, Mbp-1 antibody, Mbp1 antibody, enr antibody, fg antibody, froggy antibody, mKIAA0609 antibody, myd antibody, NV15834 antibody, DKFZp459G0120 antibody, LARGE xylosyl- and glucuronyltransferase 1 L homeolog antibody, LARGE xylosyl- and glucuronyltransferase 1 antibody, glycosyltransferase-like protein LARGE1 antibody, like-glycosyltransferase antibody, large1.L antibody, LARGE1 antibody, Large1 antibody, large1 antibody, LOC100118066 antibody, LARGE antibody, Large antibody

Background: This gene, which is one of the largest in the human genome, encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan.

Molecular Weight: 88 kDa (MW of target protein)