Golgin B1 (GOLGB1) (N-Term) antibody

Catalog No. ABIN635428

Product Details

Target: Golgin B1 (GOLGB1)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: GOLGB1 antibody was raised against the N terminal of GOLGB1

Purification: Affinity purified

Immunogen: GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOLGB1 Blocking Peptide, catalog no. 33R-6750, is also available for use as a blocking control in assays to test for specificity of this GOLGB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Golgin B1 (GOLGB1)

Alternative Name: GOLGB1 (GOLGB1 Products)

Background: GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.

Molecular Weight: 376 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome